Structure of PDB 8pmo Chain A

Receptor sequence

>8pmoA (length=116) Species: 9606 (Homo sapiens)

CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT
TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA
LLSPYSYSTTAVITNP

3D structure

• PDB: 8pmo PITB: A high affinity transthyretin aggregation inhibitor with optimal pharmacokinetic properties.
• Chain: A
• Resolution: 1.24 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZP2	A	K15 L17 A108 A109 L110	K6 L8 A99 A100 L101

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:8pmo, PDBe:8pmo, PDBj:8pmo
• PDBsum: 8pmo
• PubMed: 37837673
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)