Structure of PDB 8phz Chain A |
>8phzA (length=136) Species: 371094 (Chikungunya virus strain S27-African prototype) [Search protein sequence] |
DVVRVHPDSSLAGRKGYSTTEGALYSYLEGTRFHQTAVDMAEIYTMWPKQ TEANEQVCLYALGESIESIRQKCPVDDADASSPPKTVPCLCRYAMTPERV TRLRMNHVTSIIVCSSFPLPKYKIEGVQKVKCSKVM |
|
PDB | 8phz The alphavirus nsP3 protein forms helical tubular scaffolds important for viral replication and particle assembly |
Chain | A |
Resolution | 2.35 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C262 C287 C305 |
C89 C114 C132 |
|
|
|