Structure of PDB 8pfh Chain A

Receptor sequence
>8pfhA (length=272) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
FQFNIMVVGQSGLGKSTLINTLFASHLIDSATGDDISALPVTKTTEMKIS
THTLVEDRVRLNINVIDTPGFGDFIDNSKAWEPIVKYIKEQHSQYLRKEL
TAQRERFITDTRVHAILYFLQPNGKELSRLDVEALKRLTEIANVIPVIGK
SDTLTLDERTEFRELIQNEFEKYNFKIYPYDSEELTDEELELNRSVRSII
PFAVVGSENEIEINRGRKTRWSAINVEDINQCDFVYLREFLIRTHLQDLI
ETTSYIHYEGFRARQLIALKEN
3D structure
PDB8pfh Crystal structure of the yeast septin complex Shs1-Cdc12-Cdc3-Cdc10
ChainA
Resolution3.24 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GDP A G42 G44 K45 S46 T47 K180 V235 R251 G12 G14 K15 S16 T17 K150 V205 R217
BS02 GDP A T183 E188 T153 E158
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005200 structural constituent of cytoskeleton
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0005545 1-phosphatidylinositol binding
GO:0010314 phosphatidylinositol-5-phosphate binding
GO:0060090 molecular adaptor activity
GO:0070273 phosphatidylinositol-4-phosphate binding
Biological Process
GO:0000281 mitotic cytokinesis
GO:0000920 septum digestion after cytokinesis
GO:0000921 septin ring assembly
GO:0008104 protein localization
GO:0010458 exit from mitosis
GO:0032186 cellular bud neck septin ring organization
GO:0043934 sporulation
GO:0051301 cell division
GO:0061640 cytoskeleton-dependent cytokinesis
Cellular Component
GO:0000144 cellular bud neck septin ring
GO:0001400 mating projection base
GO:0005619 ascospore wall
GO:0005628 prospore membrane
GO:0005876 spindle microtubule
GO:0005935 cellular bud neck
GO:0005940 septin ring
GO:0015630 microtubule cytoskeleton
GO:0016020 membrane
GO:0031105 septin complex
GO:0032153 cell division site
GO:0032160 septin filament array
GO:0042764 ascospore-type prospore
GO:0043332 mating projection tip
GO:0072687 meiotic spindle
GO:1990317 Gin4 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pfh, PDBe:8pfh, PDBj:8pfh
PDBsum8pfh
PubMed38184752
UniProtP25342|CDC10_YEAST Cell division control protein 10 (Gene Name=CDC10)

[Back to BioLiP]