Structure of PDB 8pe3 Chain A

Receptor sequence

>8pe3A (length=386) Species: 1308 (Streptococcus thermophilus)

GANAMGVLISAVGDTDPFRNFHDGALIHIARKYRPEKVILIFSEHTAKKQ
GNIEKALFSIAPNYEPELIIHDPIISDNEVHIFDVMFQRFSDILQEYYTK
EDEFILNLSSATPQIKSALFVINRLNGINVKAVQVSSPEHASNENIGHDN
DENIDELIEVNKDNKVNFIDRTIEDNAEKFSQALLKKTARDFIEKFDYKA
ALDILDQLSDFPNLKSVREEIRDVVNCLSKQDVPKGLRHKKLKEEEQKIL
SAYLTIELQRERGNVSESFIRIKNLTEFILEDYIKKRYPGLIDEYCEDYL
SLFDYSKLLKATKEFKLKRTIAPIIDMNSSRNKVAHSLSPLDSDAVKQLG
IAMKTLKTLVREQYHFSQSDFNFYQDLNKILLTKLN

3D structure

• PDB: 8pe3 Activation of Csm6 ribonuclease by cyclic nucleotide binding: in an emergency, twist to open.
• Chain: A
• Resolution: 1.96 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	G9 D10 T11 R15 D19 S39 H41 D73 H77 S105 A107 T108 P109 K112 V131 P134 H136 A137 S138 N139	G13 D14 T15 R19 D23 S43 H45 D77 H81 S109 A111 T112 P113 K116 V135 P138 H140 A141 S142 N143
BS02	rna	A	T11 R15 D19 S105 K112 V131 S132 S133 P134 H136 A137 S138 N139 R167	T15 R19 D23 S109 K116 V135 S136 S137 P138 H140 A141 S142 N143 R171
BS03	rna	A	G9 D10 T11 S39 D73 V76 H77 A107 T108	G13 D14 T15 S43 D77 V80 H81 A111 T112

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0003723 RNA binding
• GO:0004519 endonuclease activity

Biological Process

• GO:0051607 defense response to virus

External links

• PDB: RCSB:8pe3, PDBe:8pe3, PDBj:8pe3
• PDBsum: 8pe3
• PubMed: 37747760
• UniProt: A0A0A7HFE6|CSM6B_STRTR CRISPR system endoribonuclease Csm6' (Gene Name=csm6')