Structure of PDB 8pdf Chain A

Receptor sequence

>8pdfA (length=107) Species: 9606 (Homo sapiens) [Search protein sequence]

GVQVETISPGDGRTFPKRGQTVVVHYTGMLEDGKKFDSSRDRNKPFKFML
GKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFD
VELLKLE

3D structure

PDB

8pdf Discovery of a Potent PROTAC Enables Targeting of FKBP51's Scaffolding Functions.

Chain

Resolution

1.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

5.2.1.8: peptidylprolyl isomerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	Y5Q	A	Y26 F36 D37 F46 E54 V55 I56 W59 Y82 H87 F99	Y26 F36 D37 F46 E54 V55 I56 W59 Y82 H87 F99

Gene Ontology

	Molecular Function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity
GO:0005160	transforming growth factor beta receptor binding
GO:0005515	protein binding
GO:0005527	macrolide binding
GO:0005528	FK506 binding
GO:0016247	channel regulator activity
GO:0030547	signaling receptor inhibitor activity
GO:0034713	type I transforming growth factor beta receptor binding
GO:0044325	transmembrane transporter binding
GO:0070411	I-SMAD binding
GO:0070697	activin receptor binding

	Biological Process
GO:0000413	protein peptidyl-prolyl isomerization
GO:0003007	heart morphogenesis
GO:0006457	protein folding
GO:0006458	'de novo' protein folding
GO:0014809	regulation of skeletal muscle contraction by regulation of release of sequestered calcium ion
GO:0022417	protein maturation by protein folding
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway
GO:0032092	positive regulation of protein binding
GO:0032880	regulation of protein localization
GO:0032926	negative regulation of activin receptor signaling pathway
GO:0042026	protein refolding
GO:0042110	T cell activation
GO:0043123	positive regulation of canonical NF-kappaB signal transduction
GO:0050776	regulation of immune response
GO:0055010	ventricular cardiac muscle tissue morphogenesis
GO:0060314	regulation of ryanodine-sensitive calcium-release channel activity
GO:0060347	heart trabecula formation
GO:0070588	calcium ion transmembrane transport
GO:0097435	supramolecular fiber organization
GO:1902991	regulation of amyloid precursor protein catabolic process
GO:1990000	amyloid fibril formation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0014802	terminal cisterna
GO:0016020	membrane
GO:0016529	sarcoplasmic reticulum
GO:0030018	Z disc
GO:0033017	sarcoplasmic reticulum membrane
GO:0098562	cytoplasmic side of membrane
GO:1990425	ryanodine receptor complex

External links

PDB	RCSB:8pdf, PDBe:8pdf, PDBj:8pdf
PDBsum	8pdf
PubMed	37942685
UniProt	P62942\|FKB1A_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP1A (Gene Name=FKBP1A)