Structure of PDB 8pc6 Chain A

Receptor sequence
>8pc6A (length=100) Species: 8355 (Xenopus laevis) [Search protein sequence]
VKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRF
QSSAVMALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB8pc6 Multivalency of nucleosome recognition by LEDGF.
ChainA
Resolution3.04 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Y41 R42 T45 R49 R72 R83 F84 V117 T118 Y7 R8 T11 R15 R38 R49 F50 V83 T84
BS02 dna A R40 G44 V46 L65 R69 R83 R6 G10 V12 L31 R35 R49
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8pc6, PDBe:8pc6, PDBj:8pc6
PDBsum8pc6
PubMed37615563
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]