Structure of PDB 8paz Chain A |
>8pazA (length=123) Species: 511 (Alcaligenes faecalis) [Search protein sequence] |
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIP EGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLD QIVSAKKPKIVQERLEKVIASAK |
|
PDB | 8paz Site-directed mutants of pseudoazurin: explanation of increased redox potentials from X-ray structures and from calculation of redox potential differences. |
Chain | A |
Resolution | 1.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H40 C78 H81 M86 |
H40 C78 H81 M86 |
|
|
|
|