Structure of PDB 8p84 Chain A

Receptor sequence

>8p84A (length=448) Species: 2304039 (Thermoanaerobacterales bacterium)

QVDVVVVGAGFAGLTAARAVHEAGRSVLVLEARDRVGGRTCTEEHHGTWI
DLGGQWIGPGQDRVAALAAELGVETYPQPTEGDDVVLFGDGEPQRAPDVA
LAFSDEELTAYLELAGALEAIAEKVPLDAPWLAPEAAAWDATTLREWVAG
TGVPDRVAGLFEVAVQAVFAATSAQLSLLHAAHYVHSAGGWSKLTDTEGG
AQQDRLVGGVQPLAERLAARLPDGALRLSTPVRGLAQDGDGVTVRTAGGE
VRARRAIVAVPPTLAGRIDHDPPLPPQRDQLLQHMPQGSVVKFHVIYDEP
WWRAEGLSGTVLCPDEPIGVTFDGTPPAGTPGIVTGFFEGPAAVAAGART
REERRDVVVDVLARTLGERARDVRDYIDRDWSAEPWTRGCYGAHLPPGAW
TVYGPALRVPVGRVHWAGTETAERWTGYIDGAIESGQRAAAEVLAALG

3D structure

• PDB: 8p84 Discovery and structural characterization of a thermostable bacterial monoamine oxidase.
• Chain: A
• Resolution: 1.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	V11 G12 G14 A16 E35 A36 R37 G42 R43 G57 G58 Q59 W60 V236 V264 K296 W385 W390 C394 Y395 G422 T423 G431 Y432 I433 A436	V7 G8 G10 A12 E31 A32 R33 G38 R39 G53 G54 Q55 W56 V232 V260 K292 W381 W386 C390 Y391 G418 T419 G427 Y428 I429 A432

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 30 19:04:17 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8p84', asym_id = 'A', title = 'Discovery and structural characterization of a thermostable bacterial monoamine oxidase.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8p84', asym_id='A', title='Discovery and structural characterization of a thermostable bacterial monoamine oxidase.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016491', uniprot = '', pdbid = '8p84', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016491', uniprot='', pdbid='8p84', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>