Structure of PDB 8p7b Chain A

Receptor sequence

>8p7bA (length=239) Species: 9606 (Homo sapiens)

TLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSQKLT
MLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVKQNPLYDTERCKV
FQCDLTKDDLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLKPG
KSVLFRDYGLYDHAMLRFKASSKLGENFYVRQDGTRSYFFTDDFLAQLFM
DTGYEEVVNEYVFRETVNKKEGLCVPRVFLQSKFLKPPK

3D structure

• PDB: 8p7b Structural basis of the cooperation between the m3C-RNA-methyltransferase METTL6 with SerRS amino-acyl-synthetase for tRNA recognition
• Chain: A
• Resolution: 2.42 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	K43 D46 L47 K50 N52 N55 F56 F57 K58 D59 R60 H61 W62 R114 F158 Y190 H195 R199 R213 Q214 R246 T248 N250 K251 K252 R259 F261	K17 D20 L21 K24 N26 N29 F30 F31 K32 D33 R34 H35 W36 R82 F126 Y158 H163 R167 R181 Q182 R214 T216 N218 K219 K220 R227 F229
BS02	SAH	A	W45 Y49 R60 G87 C93 D110 F111 L137 I157	W19 Y23 R34 G55 C61 D78 F79 L105 I125

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008168 methyltransferase activity
• GO:0008173 RNA methyltransferase activity
• GO:0008757 S-adenosylmethionine-dependent methyltransferase activity
• GO:0019899 enzyme binding
• GO:0052735 tRNA (cytidine-3-)-methyltransferase activity

Biological Process

• GO:0006400 tRNA modification
• GO:0008033 tRNA processing
• GO:0030488 tRNA methylation
• GO:0032259 methylation

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:8p7b, PDBe:8p7b, PDBj:8p7b
• PDBsum: 8p7b
• PubMed: 38918637
• UniProt: Q8TCB7|METL6_HUMAN tRNA N(3)-methylcytidine methyltransferase METTL6 (Gene Name=METTL6)