Structure of PDB 8ovj Chain A

Receptor sequence

>8ovjA (length=255) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

GKTVLSCRKGNGSVYQVHGHKRLGPAKLRILDYAERHGYMRGVVKSIEHE
AGRGAALARVEFRHPYKFRRVKELMVAPEGMFTGQSVFCGQKAPLAIGNV
LPLGQITEGCIVCNVEAKPGDRGTLARASGDYCIIISHNHETGRTRLKLP
SGQKKSVPSTSRAMIGIISGGGRIEKPVLKAGNSFYRFRGKRNCWPKVRG
VARNPVEHPHGGGNHQHIGHPSTVSRHSPPGQKVGLIAARRTGRIRGGKA
VKGAW

3D structure

PDB

8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	A	K3 T4 R9 S14 Y16 H19 H21 P26 K181 A182 G183 F186 Y187 W196 V199 N205 V207 E208	K2 T3 R8 S13 Y15 H18 H20 P25 K180 A181 G182 F185 Y186 W195 V198 N204 V206 E207
BS02	rna	A	K22 H50 F69 R174 K177 Y187 R188	K21 H49 F68 R173 K176 Y186 R187
BS03	rna	A	G248 G249	G247 G248
BS04	rna	A	G2 C8 G11 N12 V18 G20 R23 G25 Y34 R37 Y40 R54 R64 Y67 F69 R71 F83 G85 P95 T125 L126 A127 R128 A129 S130 D132 L150 P151 S152 K156 R174 V179 L180 S185 R193 W196 K198 V199 R200 G201 V202 H211 G214 N215 H216 Q217 H218 I219 G220 H221 P222 S223 T224 R227 H228 P230 G232 Q233 K234 G236 I238 A240 R241 R242 T243 G244 I246 K253 G254	G1 C7 G10 N11 V17 G19 R22 G24 Y33 R36 Y39 R53 R63 Y66 F68 R70 F82 G84 P94 T124 L125 A126 R127 A128 S129 D131 L149 P150 S151 K155 R173 V178 L179 S184 R192 W195 K197 V198 R199 G200 V201 H210 G213 N214 H215 Q216 H217 I218 G219 H220 P221 S222 T223 R226 H227 P229 G231 Q232 K233 G235 I237 A239 R240 R241 T242 G243 I245 K252 G253

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ovj, PDBe:8ovj, PDBj:8ovj
PDBsum	8ovj
PubMed	38722744
UniProt	Q4FWX5

[Back to BioLiP]