Structure of PDB 8oj8 Chain A

Receptor sequence
>8oj8A (length=474) Species: 9606 (Homo sapiens) [Search protein sequence]
DIYSRTQSTWVDSFFRQNGYLEFDALSRLGIPDAVSYIKKRYKTTQLLFL
KAACVGQGLVDQVEASVEEAISSGTWVDIAPLLPTSLSVEDAAILLQQVM
RAFSKQASTVVFSDTVVVSEKFINDCTELFRELMHQKAEKEMKDKKDERR
RKATEGSGSMRGGGGGNAREYKIKKVQDEIEDFLRKHIQDAPEEFISELA
EYLIKPLNKTYLEVVRSVFMSSTTSASGTGRKRTIKDLQEEVSNLYNNIR
LFEKGMKFFADDTQAALTKHLLKSVCTDITNLIFNFLASDLMMAVDDPAA
ITSEIRKKILSKLSEETKVALTKLHNSLNEKSIEDFISCLDSAAEACDIM
VKRGDKKRERQILFQHRQALAEQLKVTEDPALILHLTSVLLFQFSTHSML
HAPGRCVPQIIAFLNSKIPEDQHALLVKYQGLVVKQLVSQSKKTGLDKEQ
EDVASTTRKELQELSSSIKDLVLK
3D structure
PDB8oj8 UFM1 E3 ligase promotes recycling of 60S ribosomal subunits from the ER
ChainA
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.3.2.-
Interaction with ligand
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0016740 transferase activity
GO:0019901 protein kinase binding
GO:0061666 UFM1 ligase activity
GO:0071568 UFM1 transferase activity
Biological Process
GO:0000077 DNA damage checkpoint signaling
GO:0001649 osteoblast differentiation
GO:0002841 negative regulation of T cell mediated immune response to tumor cell
GO:0006281 DNA repair
GO:0006974 DNA damage response
GO:0008284 positive regulation of cell population proliferation
GO:0010468 regulation of gene expression
GO:0010508 positive regulation of autophagy
GO:0030218 erythrocyte differentiation
GO:0031397 negative regulation of protein ubiquitination
GO:0032088 negative regulation of NF-kappaB transcription factor activity
GO:0032434 regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032790 ribosome disassembly
GO:0032880 regulation of protein localization
GO:0033146 regulation of intracellular estrogen receptor signaling pathway
GO:0034976 response to endoplasmic reticulum stress
GO:0043066 negative regulation of apoptotic process
GO:0043122 regulation of canonical NF-kappaB signal transduction
GO:0050727 regulation of inflammatory response
GO:0050821 protein stabilization
GO:0050868 negative regulation of T cell activation
GO:0060218 hematopoietic stem cell differentiation
GO:0060252 positive regulation of glial cell proliferation
GO:0061709 reticulophagy
GO:0071569 protein ufmylation
GO:0072344 rescue of stalled ribosome
GO:0140501 positive regulation of reticulophagy
GO:1902065 response to L-glutamate
GO:1903052 positive regulation of proteolysis involved in protein catabolic process
GO:1903895 negative regulation of IRE1-mediated unfolded protein response
GO:1990592 protein K69-linked ufmylation
Cellular Component
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005741 mitochondrial outer membrane
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0035861 site of double-strand break
GO:0043005 neuron projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8oj8, PDBe:8oj8, PDBj:8oj8
PDBsum8oj8
PubMed38383785
UniProtO94874|UFL1_HUMAN E3 UFM1-protein ligase 1 (Gene Name=UFL1)

[Back to BioLiP]