Structure of PDB 8odq Chain A |
>8odqA (length=150) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] |
LRLEQIYQDVILDHYKHPQHRGLREPFGAQVYHVNPICGDEVTLRVALSE DGTRVTDVSYDGQGCSISQAATSVLTEQVIGQRVPRALNIVDAFTEMVSS RGTVPGDEDVLGDGVAFAGVAKYPARVKCALLGWMAFKDALAQASEAFEE |
|
PDB | 8odq Structural and Biochemical Characterization of Mycobacterium tuberculosis Zinc SufU-SufS Complex. |
Chain | A |
Resolution | 1.65 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
D42 C67 C131 |
D40 C65 C129 |
|
|
|
|