Structure of PDB 8kfv Chain A

Receptor sequence

>8kfvA (length=163) Species: 4577 (Zea mays) [Search protein sequence]

GWVIGVDPDIGGAIAVLSPDGSSQVFDNPFVHIVVSEVIRKRLDTKSIIQ
LLRGLDAPPGTTAYIEKSSPFPTDGKQGWWSTGFSYGLWIASLVASGFSV
VPIASQTWKAYFGLMRSETPADDSRQAASILFPDKDQSLKLKKHHGRAEA
LLLAAYGKGLVLP

3D structure

PDB

8kfv MOC1 cleaves Holliday junctions through a cooperative nick and counter-nick mechanism mediated by metal ions.

Chain

Resolution

2.19 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	V143 S144 R148 D182 G183 K184 Q185 G186 L249 K250 K251	V35 S36 R40 D74 G75 K76 Q77 G78 L141 K142 K143
BS02	dna	A	K175 S177 F179 P180 D182 W187 A212 S213 Q214 K217 M223 R224	K67 S69 F71 P72 D74 W79 A104 S105 Q106 K109 M115 R116
BS03	dna	A	D117 I118 R148 R150 D182 G186 S189 E257	D9 I10 R40 R42 D74 G78 S81 E149
BS04	MN	A	D115 D117 E257	D7 D9 E149
BS05	MN	A	D115 E174 E257	D7 E66 E149

External links

PDB	RCSB:8kfv, PDBe:8kfv, PDBj:8kfv
PDBsum	8kfv
PubMed	38886375
UniProt	B4FCI7

[Back to BioLiP]