Structure of PDB 8k9p Chain A |
>8k9pA (length=124) Species: 511 (Alcaligenes faecalis) [Search protein sequence] |
ASENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDM IPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPAN LDQIVSAKKPKIVQERLEKVIASA |
|
PDB | 8k9p Overlooked Hydrogen Bond in a Blue Copper Protein Uncovered by Neutron and Sub- angstrom ngstrom Resolution X-ray Crystallography |
Chain | A |
Resolution | 1.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H40 C78 H81 M86 |
H42 C80 H83 M88 |
|
|
|
|