Structure of PDB 8k9f Chain A

Receptor sequence

>8k9fA (length=218) Species: 324602 (Chloroflexus aurantiacus J-10-fl) [Search protein sequence]

AQIFPRNANLLSRLSIFALVLLVVEGILILGVYFRSNYFRQVNVAIEQPV
AFSHQLHVNVVGIDCRYCHTSVDQSYFANIPATETCMTCHSQIKTYSPLL
EKVRESYATGKPIEWVKVYDLPNFVYFNHSIHVNKGIGCSTCHGQVNNMP
VVWQQQALYMGWCLNCHRNPELYVRPREEVYNMDYVPPSNQLEIGRQLVA
EYGIMPPDQLTNCYVCHR

3D structure

PDB

8k9f Cryo-EM structure of HQNO-bound Alternative Complex III from the anoxygenic phototrophic bacterium Chloroflexus aurantiacus.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEC	A	R41 V126 Y160 M161 C164 L165 H168 C214 C217 H218	R40 V125 Y159 M160 C163 L164 H167 C213 C216 H217
BS02	HEC	A	V126 F128 I132 H133 K136 I138 C164 C167 H168 I205 M206 Q210 L211 V216 C217	V125 F127 I131 H132 K135 I137 C163 C166 H167 I204 M205 Q209 L210 V215 C216
BS03	HEC	A	C66 H70 V73 F78 A79 Y120 L122 F128 H130 G139 C140 C143 H144	C65 H69 V72 F77 A78 Y119 L121 F127 H129 G138 C139 C142 H143
BS04	HEC	A	F53 H55 V59 I64 D65 C66 C69 H70 I81 P82 W116 V119 Y120 C140 V147	F52 H54 V58 I63 D64 C65 C68 H69 I80 P81 W115 V118 Y119 C139 V146
BS05	HEC	A	F53 H58 V62 C87 C90 H91 I94 K95 L101	F52 H57 V61 C86 C89 H90 I93 K94 L100

Gene Ontology

	Cellular Component
GO:0016020	membrane

View graph for
Cellular Component

External links

PDB	RCSB:8k9f, PDBe:8k9f, PDBj:8k9f
PDBsum	8k9f
PubMed	38299372
UniProt	A9WEV2

[Back to BioLiP]