Structure of PDB 8jzx Chain A

Receptor sequence
>8jzxA (length=455) Species: 9606 (Homo sapiens) [Search protein sequence]
RRAAAAAAAAGAFAGRRAACGAVLLTELLERAAFYGITSNLVLFLNGAPF
CWEGAQASEALLLFMGLTYLGSPFGGWLADARLGRARAILLSLALYLLGM
LAFPLLAAPATRAALCGSARCCSPATFAGLVLVGLGVATVKANITPFGAD
QVKDRGPEATRRFFNWFYWSINLGAILSLGGIAYIQQNVSFVTGYAIPTV
CVGLAFVVFLCGQSVFIEDVKALVKIVPVFLALIPYWTVYFQMQTTYVLQ
SLHLRIPEISNPHTLPAAWLTMFDAVLILLLIPLKDKLVDPILRRHGLLP
SSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYHAADL
SLWWQVPQYLLIGISEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGVG
SFVGSGLLALVSIKAIGWMSSGNINGCYLNYYFFLLAAIQGATLLLFLII
SVKYD
3D structure
PDB8jzx A conformation-locking inhibitor of SLC15A4 with TASL proteostatic anti-inflammatory activity
ChainA
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CLR A L551 I552 L448 I449
BS02 Q09 A Y52 I202 W332 Q339 D373 A468 S469 L473 F492 F493 Y35 I171 W237 Q244 D274 A369 S370 L374 F393 F394
BS03 CLR A A418 L422 W453 A319 L323 W354
BS04 CLR A F417 A541 F318 A438
BS05 CLR A L392 L397 F411 L293 L298 F312
Gene Ontology
Molecular Function
GO:0005290 L-histidine transmembrane transporter activity
GO:0005515 protein binding
GO:0015293 symporter activity
GO:0015333 peptide:proton symporter activity
GO:0015647 peptidoglycan transmembrane transporter activity
GO:0022857 transmembrane transporter activity
GO:0071916 dipeptide transmembrane transporter activity
Biological Process
GO:0006811 monoatomic ion transport
GO:0006857 oligopeptide transport
GO:0015031 protein transport
GO:0015817 histidine transport
GO:0015833 peptide transport
GO:0015835 peptidoglycan transport
GO:0033023 mast cell homeostasis
GO:0034157 positive regulation of toll-like receptor 7 signaling pathway
GO:0034161 positive regulation of toll-like receptor 8 signaling pathway
GO:0034165 positive regulation of toll-like receptor 9 signaling pathway
GO:0045087 innate immune response
GO:0045089 positive regulation of innate immune response
GO:0048302 regulation of isotype switching to IgG isotypes
GO:0055085 transmembrane transport
GO:0070424 regulation of nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway
GO:0070430 positive regulation of nucleotide-binding oligomerization domain containing 1 signaling pathway
GO:0070434 positive regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway
GO:0089708 L-histidine transmembrane export from vacuole
GO:0140206 dipeptide import across plasma membrane
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005764 lysosome
GO:0005765 lysosomal membrane
GO:0005768 endosome
GO:0005886 plasma membrane
GO:0010008 endosome membrane
GO:0016020 membrane
GO:0031901 early endosome membrane
GO:0035579 specific granule membrane
GO:0036020 endolysosome membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8jzx, PDBe:8jzx, PDBj:8jzx
PDBsum8jzx
PubMed37863876
UniProtQ8N697|S15A4_HUMAN Solute carrier family 15 member 4 (Gene Name=SLC15A4)

[Back to BioLiP]