Structure of PDB 8jzg Chain A

Receptor sequence

>8jzgA (length=385) Species: 196627 (Corynebacterium glutamicum ATCC 13032)

AQPTAVRLFTSESVTEGHPDKICDAISDTILDALLEKDPQSRVAVETVVT
TGIVHVVGEVRTSAYVEIPQLVRNKLIEIGFNSSEVGFDGRTCGVSVSIG
EQEDDRAGAGDQGLMFGYATNETEEYMPLPIALAHRLSRRLTQVRKEGIV
PHLRPDGKTQVTFAYDAQDRPSHLDTVVISTQHDPEVDRAWLETQLREHV
IDWVIKDAGIEDLATGEITVLINPSGSFILGGPMGDAGLTGRKIIVDTYG
GMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNIVAAGLADRAEVQVAYAI
GRAKPVGLYVETFDTNKEGLSDEQIQAAVLEVFDLRPAAIIRELDLLRPI
YADTAAYGHFGRTDLDLPWEAIDRVDELRAALKLA

3D structure

• PDB: 8jzg Structural and Biochemical Studies on Product Inhibition of S-Adenosylmethionine Synthetase from Corynebacterium glutamicum.
• Chain: A
• Resolution: 2.39 Å

Enzymatic activity

• Enzyme Commision number: 2.5.1.6: methionine adenosyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADN	A	H19 D178 K180 S202 S247 F250 D258	H18 D156 K158 S180 S225 F228 D236
BS02	3PO	A	H19 D21 K180 R264 K265	H18 D20 K158 R242 K243
BS03	SAM	A	V61 T63 S64 A65 Y66 V67 I69	V60 T62 S63 A64 Y65 V66 I68
BS04	POP	A	H56 S97	H55 S96
BS05	3PO	A	K285 D291	K263 D269

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004478 methionine adenosyltransferase activity
• GO:0005524 ATP binding
• GO:0016740 transferase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006556 S-adenosylmethionine biosynthetic process
• GO:0006730 one-carbon metabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:8jzg, PDBe:8jzg, PDBj:8jzg
• PDBsum: 8jzg
• PubMed: 37846083
• UniProt: Q9K5E4|METK_CORGL S-adenosylmethionine synthase (Gene Name=metK)