Structure of PDB 8jug Chain A

Receptor sequence

>8jugA (length=162) Species: 9606 (Homo sapiens)

GYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLH
FRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFD
EDERWTDGSSLGINFLYAATHQLGHSLGMGHSSDPNAVMYPTYNFKLSQD
DIKGIQKLYGKR

3D structure

• PDB: 8jug Structure-Based Optimization and Biological Evaluation of Potent and Selective MMP-7 Inhibitors for Kidney Fibrosis.
• Chain: A
• Resolution: 1.3 Å

Enzymatic activity

• Enzyme Commision number: 3.4.24.23: matrilysin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	F98 Y167 T175 L176 A177 H178 A179 F180 A211 H214 Q215 H218 H224 P234	F5 Y74 T82 L83 A84 H85 A86 F87 A118 H121 Q122 H125 H131 P141
BS02	CA	A	D153 A181 G185 G187 D189	D60 A88 G92 G94 D96
BS03	CA	A	D170 G171 G173 T175 D193 E196	D77 G78 G80 T82 D100 E103
BS04	ZN	A	H163 D165 H178 H191	H70 D72 H85 H98
BS05	ZN	A	H214 H218 H224	H121 H125 H131

Gene Ontology

Molecular Function

• GO:0004222 metalloendopeptidase activity
• GO:0008237 metallopeptidase activity
• GO:0008270 zinc ion binding

Biological Process

• GO:0006508 proteolysis

Cellular Component

• GO:0031012 extracellular matrix

External links

• PDB: RCSB:8jug, PDBe:8jug, PDBj:8jug
• PDBsum: 8jug
• PubMed: 37861435
• UniProt: P09237|MMP7_HUMAN Matrilysin (Gene Name=MMP7)