Structure of PDB 8jrv Chain A

Receptor sequence
>8jrvA (length=355) Species: 9606 (Homo sapiens) [Search protein sequence]
TRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYV
TLTAAFRYGRFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYP
FTFEIPPNLPSSVTLQPGPEDTGKAIGVDYEVKAFVAENLEEKIHKRNSV
RLVIEKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPI
SVNVHVTNNTNKTVKKIKISVRQYADIVLFNTAQYKVPVAMEEADDTVAP
SSTFSKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREI
LGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHRE
VPEHE
3D structure
PDB8jrv Tail engagement of arrestin at the glucagon receptor.
ChainA
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PIO A R236 K324 K326 R222 K310 K312
Gene Ontology
Molecular Function
GO:0001664 G protein-coupled receptor binding
GO:0003713 transcription coactivator activity
GO:0004402 histone acetyltransferase activity
GO:0004857 enzyme inhibitor activity
GO:0005096 GTPase activator activity
GO:0005159 insulin-like growth factor receptor binding
GO:0005515 protein binding
GO:0031625 ubiquitin protein ligase binding
GO:0031701 angiotensin receptor binding
GO:1990763 arrestin family protein binding
Biological Process
GO:0001934 positive regulation of protein phosphorylation
GO:0002031 G protein-coupled receptor internalization
GO:0002092 positive regulation of receptor internalization
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0007165 signal transduction
GO:0007601 visual perception
GO:0009968 negative regulation of signal transduction
GO:0015031 protein transport
GO:0016567 protein ubiquitination
GO:0031397 negative regulation of protein ubiquitination
GO:0032088 negative regulation of NF-kappaB transcription factor activity
GO:0032715 negative regulation of interleukin-6 production
GO:0032717 negative regulation of interleukin-8 production
GO:0035025 positive regulation of Rho protein signal transduction
GO:0043149 stress fiber assembly
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0045746 negative regulation of Notch signaling pathway
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0070374 positive regulation of ERK1 and ERK2 cascade
Cellular Component
GO:0000139 Golgi membrane
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005765 lysosomal membrane
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005905 clathrin-coated pit
GO:0016604 nuclear body
GO:0030659 cytoplasmic vesicle membrane
GO:0030666 endocytic vesicle membrane
GO:0031143 pseudopodium
GO:0031410 cytoplasmic vesicle
GO:0042995 cell projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8jrv, PDBe:8jrv, PDBj:8jrv
PDBsum8jrv
PubMed37558880
UniProtP49407|ARRB1_HUMAN Beta-arrestin-1 (Gene Name=ARRB1)

[Back to BioLiP]