Structure of PDB 8jqo Chain A

Receptor sequence

>8jqoA (length=391) Species: 54067 (Xylophilus ampelinus)

MRTQVGIVGAGPAGLMLAHLLRREGIDAVVIERAAREHVRTRLRAGVLEQ
GTVEMLREAGVGGRIDAVGMEMHAIDFRFGGRSHRLDFHEASGGRRAWVY
PQHEVVTDLMSACDAGDVPILYEAPVERIEGLEDDRARIVFGQDGAAGEI
TCDFVAGCDGFRGVSRGSMPAGIARGYDRIYPFGWLGILADAPPASPDVT
WGCSDRGFAMMSMRSPTVTRLYLQCEPDEDPDAWSDDRIWSELHRRLDVE
GMPSLREGPIRDKGVTAMRSFLSEPMQHGRLFLAGDAAHIVPPTGAKGLN
SAMADIKVLAAALVDHYRHGRSDRLATYSERCLRRMWLVQRFSAALCTMV
HQFPGQNEFVRRLQRADLDYMTGTHAGRLQFAENFTGLPIE

3D structure

• PDB: 8jqo Protocatechuate hydroxylase is a novel group A flavoprotein monooxygenase with a unique substrate recognition mechanism
• Chain: A
• Resolution: 1.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	G11 P12 A13 E32 R33 R42 R44 V47 Q102 V126 D159 G160 G285 D286 A296 K297 G298 L299 N300	G11 P12 A13 E32 R33 R42 R44 V47 Q102 V126 D159 G160 G285 D286 A296 K297 G298 L299 N300

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Nov 27 20:22:55 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8jqo', asym_id = 'A', title = 'Protocatechuate hydroxylase is a novel group A f...ase with a unique substrate recognition mechanism'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8jqo', asym_id='A', title='Protocatechuate hydroxylase is a novel group A f...ase with a unique substrate recognition mechanism')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0071949', uniprot = '', pdbid = '8jqo', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0071949', uniprot='', pdbid='8jqo', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>