Structure of PDB 8jku Chain A

Receptor sequence

>8jkuA (length=285) Species: 32630 (synthetic construct)

NTPVTVIGLGPMGRALAGAFLAAGHPTTVWNRTPGKADALVARGAVRAAT
VAEAVAASPLVVVCVTDYDAMRAILEPAADALAGRVLVNLTSDTPERARE
AAAWAAEHGADYLDGAIMVPPPMIGTPEALIFYSGPREVFEAHRATLAAL
GGSTYLGEDPGLAALYDVALLDLFWTTMSGYLHAAALVGSEGVPAAEFAP
FATAIFDSLSFLEEMAEQIDAGEYPGDESTLAMNAAGIDHIIHASRAQGI
DTALPEAVKALAERAIAAGHGEDSFTSVIEVLRKP

3D structure

• PDB: 8jku Structure of ancestral imine reductase at 2.56 Angstroms resolution.
• Chain: A
• Resolution: 2.57 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	A	G11 L12 G13 P14 M15 N34 R35 T36 K39 C67 V68 T69 A73 I77 S95 I120 V122 P124	G8 L9 G10 P11 M12 N31 R32 T33 K36 C64 V65 T66 A70 I74 S92 I117 V119 P121

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Feb 21 21:39:25 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8jku', asym_id = 'A', title = 'Structure of ancestral imine reductase at 2.56 Angstroms resolution.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8jku', asym_id='A', title='Structure of ancestral imine reductase at 2.56 Angstroms resolution.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016491,0050661', uniprot = '', pdbid = '8jku', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016491,0050661', uniprot='', pdbid='8jku', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>