Structure of PDB 8jjt Chain A

Receptor sequence

>8jjtA (length=320) Species: 34073 (Variovorax paradoxus)

NPSLVIVSPALPGANNGNWRTAQRWKALLSPVCSARVVQQWPDADASADT
VMLALHARRSAESIAHWAHAHPGRGLGVVLTGTDLYQDIGSDPQAQRSLQ
LAQRLVVLQALGAEALPPECRAKARVVYQSTSARAELPKSARQLRAVMVG
HLRQVKSPQTLFDAARLLCGREDIRIDHIGDAGDAGLGELARALASDCPG
YRWLGALPHAQTRQRIQRAHVLVHTSALEGGAHVIMEAVRSGTPVLASRV
PGNVGMLGNDYAGYFPHGDAAALAALLEACRAGQAGLLDSLRTQCALRAP
LFDPRAEQAALFQLLNELQP

3D structure

• PDB: 8jjt Structure of SenB in complex with UDP-GlcNAc at 1.88 Angstroms resolution
• Chain: A
• Resolution: 1.88 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	UD1	A	N17 G19 N20 R22 T23 T83 V151 H153 R155 V157 K158 I181 A208 L209 H211 T214 E231 G232 G233 A234 H235 V236 E239	N15 G17 N18 R20 T21 T81 V149 H151 R153 V155 K156 I179 A206 L207 H209 T212 E229 G230 G231 A232 H233 V234 E237

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Dec 3 04:23:59 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8jjt', asym_id = 'A', title = 'Structure of SenB in complex with UDP-GlcNAc at 1.88 Angstroms resolution'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8jjt', asym_id='A', title='Structure of SenB in complex with UDP-GlcNAc at 1.88 Angstroms resolution')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016757', uniprot = '', pdbid = '8jjt', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016757', uniprot='', pdbid='8jjt', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>