Structure of PDB 8jho Chain A

Receptor sequence
>8jhoA (length=102) Species: 8355 (Xenopus laevis) [Search protein sequence]
GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL
RFQSSAVMALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRG
ER
3D structure
PDB8jho Structure of histone deacetylase complex Rpd3S bound to nucleosome
ChainA
Resolution7.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A H39 R40 Y41 G44 V46 A47 R53 R63 K64 L65 R69 R83 H7 R8 Y9 G12 V14 A15 R21 R31 K32 L33 R37 R51
BS02 dna A K37 R40 Y41 R42 T45 R63 R72 R83 F84 Q85 S86 R116 V117 T118 K5 R8 Y9 R10 T13 R31 R40 R51 F52 Q53 S54 R84 V85 T86
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8jho, PDBe:8jho, PDBj:8jho
PDBsum8jho
PubMed37798513
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]