Structure of PDB 8jfi Chain A

Receptor sequence
>8jfiA (length=248) Species: 210 (Helicobacter pylori) [Search protein sequence]
SMQFTGKNVLITGASKGIGAEIARTLASMGLKVWINYRSNAEVADALKNE
LEEKGYKAAVIKFDAASESDFVEAIQAIVQSDGGLSYLVNNAGVVRDKLA
IKMKTEDFHHVIDNNLTSAFIGCREALKVMSKSRFGSVVNIASIIGERGN
MGQTNYSASKGGMIAMSKSFAYEGALRNIRFNSVTPGFIETDMNANLKDE
LKADYVKNIPLNRLGAAKEVAEAVAFLLSDHSSYITGETLKVNGGLYM
3D structure
PDB8jfi The Molecular Basis of Catalysis by SDR Family Members Ketoacyl-ACP Reductase FabG and Enoyl-ACP Reductase FabI in Type-II Fatty Acid Biosynthesis.
ChainA
Resolution2.38 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAP A G12 I17 R37 D63 A64 N90 A91 G92 I140 A141 S142 Y155 K159 P185 T190 D191 M192 N193 G13 I18 R38 D64 A65 N91 A92 G93 I141 A142 S143 Y156 K160 P186 T191 D192 M193 N194
BS02 UHC A D96 S142 M150 Q152 Y155 F187 M192 Y204 D97 S143 M151 Q153 Y156 F188 M193 Y205
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 30 23:19:42 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8jfi', asym_id = 'A', title = 'The Molecular Basis of Catalysis by SDR Family M...ductase FabI in Type-II Fatty Acid Biosynthesis. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8jfi', asym_id='A', title='The Molecular Basis of Catalysis by SDR Family M...ductase FabI in Type-II Fatty Acid Biosynthesis. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0004316,0006633,0016491,0051287', uniprot = '', pdbid = '8jfi', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004316,0006633,0016491,0051287', uniprot='', pdbid='8jfi', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>