Structure of PDB 8jfa Chain A

Receptor sequence
>8jfaA (length=234) Species: 210 (Helicobacter pylori) [Search protein sequence]
MQFTGKNVLITGASKGIGAEIARTLASMGLKVWINYRSNAEVADALKNEL
EEKGYKAAVIKFDAASESDFVEAIQAIVQSDGGLSYLVNNAGVVRDKLAI
KMKTEDFHHVIDNNLTSAFIGCREALKVMSKSRFGSVVNIASIIGERGNM
GQTNYSASKGGMIAMSKSFAYEGALRNIRFNSVTPGFIEDYVKNIPLNRL
GAAKEVAEAVAFLLSDHSSYITGETLKVNGGLYM
3D structure
PDB8jfa The Molecular Basis of Catalysis by SDR Family Members Ketoacyl-ACP Reductase FabG and Enoyl-ACP Reductase FabI in Type-II Fatty Acid Biosynthesis.
ChainA
Resolution2.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 NAP A G12 K15 I17 N35 R37 A64 N90 A91 G92 A141 S142 Y155 K159 P185 G186 G12 K15 I17 N35 R37 A64 N90 A91 G92 A141 S142 Y155 K159 P185 G186
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sun Dec 1 00:00:24 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8jfa', asym_id = 'A', title = 'The Molecular Basis of Catalysis by SDR Family M...ductase FabI in Type-II Fatty Acid Biosynthesis. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8jfa', asym_id='A', title='The Molecular Basis of Catalysis by SDR Family M...ductase FabI in Type-II Fatty Acid Biosynthesis. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0004316,0006633,0016491,0051287', uniprot = '', pdbid = '8jfa', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004316,0006633,0016491,0051287', uniprot='', pdbid='8jfa', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>