Structure of PDB 8j8z Chain A

Receptor sequence
>8j8zA (length=340) Species: 10116 (Rattus norvegicus) [Search protein sequence]
TRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYV
TLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLI
KKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLE
EKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDK
EIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAM
EEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTL
LREGANREILGIIVSYKVKVKLVVDVAVELPFTLMHPKPK
3D structure
PDB8j8z Molecular insights into atypical modes of beta-arrestin interaction with seven transmembrane receptors
ChainA
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A T6 R7 V8 K10 K11 R25 R103 K107 T1 R2 V3 K5 K6 R20 R98 K102
Gene Ontology
Molecular Function
GO:0001664 G protein-coupled receptor binding
GO:0003713 transcription coactivator activity
GO:0004402 histone acetyltransferase activity
GO:0005096 GTPase activator activity
GO:0005102 signaling receptor binding
GO:0005159 insulin-like growth factor receptor binding
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0030276 clathrin binding
GO:0030331 nuclear estrogen receptor binding
GO:0031434 mitogen-activated protein kinase kinase binding
GO:0031625 ubiquitin protein ligase binding
GO:0031691 alpha-1A adrenergic receptor binding
GO:0031692 alpha-1B adrenergic receptor binding
GO:0031701 angiotensin receptor binding
GO:0031762 follicle-stimulating hormone receptor binding
GO:0031896 V2 vasopressin receptor binding
GO:0035612 AP-2 adaptor complex binding
GO:0035615 clathrin adaptor activity
GO:0043027 cysteine-type endopeptidase inhibitor activity involved in apoptotic process
GO:0044325 transmembrane transporter binding
GO:0045309 protein phosphorylated amino acid binding
GO:0051219 phosphoprotein binding
GO:1990763 arrestin family protein binding
Biological Process
GO:0001934 positive regulation of protein phosphorylation
GO:0002031 G protein-coupled receptor internalization
GO:0002092 positive regulation of receptor internalization
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0006897 endocytosis
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007601 visual perception
GO:0007602 phototransduction
GO:0008277 regulation of G protein-coupled receptor signaling pathway
GO:0008284 positive regulation of cell population proliferation
GO:0009410 response to xenobiotic stimulus
GO:0009968 negative regulation of signal transduction
GO:0015031 protein transport
GO:0016567 protein ubiquitination
GO:0031397 negative regulation of protein ubiquitination
GO:0031398 positive regulation of protein ubiquitination
GO:0032715 negative regulation of interleukin-6 production
GO:0032717 negative regulation of interleukin-8 production
GO:0034393 positive regulation of smooth muscle cell apoptotic process
GO:0035025 positive regulation of Rho protein signal transduction
GO:0035774 positive regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0042699 follicle-stimulating hormone signaling pathway
GO:0042981 regulation of apoptotic process
GO:0043066 negative regulation of apoptotic process
GO:0043149 stress fiber assembly
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043278 response to morphine
GO:0043410 positive regulation of MAPK cascade
GO:0043524 negative regulation of neuron apoptotic process
GO:0045746 negative regulation of Notch signaling pathway
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0050975 sensory perception of touch
GO:0070373 negative regulation of ERK1 and ERK2 cascade
GO:0070374 positive regulation of ERK1 and ERK2 cascade
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005905 clathrin-coated pit
GO:0014069 postsynaptic density
GO:0016323 basolateral plasma membrane
GO:0031143 pseudopodium
GO:0031410 cytoplasmic vesicle
GO:0042995 cell projection
GO:0043197 dendritic spine
GO:0045211 postsynaptic membrane
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8j8z, PDBe:8j8z, PDBj:8j8z
PDBsum8j8z
PubMed38175886
UniProtP29066|ARRB1_RAT Beta-arrestin-1 (Gene Name=Arrb1)

[Back to BioLiP]