Structure of PDB 8j6w Chain A

Receptor sequence
>8j6wA (length=145) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
DNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGL
ATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEF
SDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEG
3D structure
PDB8j6w Full length crystal structure of Escherichia coli Fur
ChainA
Resolution2.66 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A H87 D89 E108 H125 H85 D87 E106 H123
BS02 ZN A H33 E81 H88 H90 H31 E79 H86 H88
BS03 ZN A D95 H132 D93 H130
BS04 ZN A C93 C96 C138 H145 C91 C94 C136 H143
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001216 DNA-binding transcription activator activity
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:1900705 negative regulation of siderophore biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8j6w, PDBe:8j6w, PDBj:8j6w
PDBsum8j6w
PubMed
UniProtP0A9A9|FUR_ECOLI Ferric uptake regulation protein (Gene Name=fur)

[Back to BioLiP]