Structure of PDB 8j1j Chain A

Receptor sequence

>8j1jA (length=424) Species: 1765684 (Sulfoacidibacillus thermotolerans)

GSMIKVYRYEIVKPLDLDWKEFGTILRQLQQETRFALNKATQLAWEWMGY
SSDYKDNHGEYPKSKDILGYTNVHGYAYHTIKTKAYRLNSGNLSQTIKRA
TDRFKAYQKEILRGDMSIPSYKRDIPLDLIKENISVNRMNHGDYIASLSL
LSNPAKQEMNVKRKISVIIIVRGAGKTIMDRILSGEYQVHASQIIHDDRK
NKWYLNISYDFEPQTRVLDLNKIMGIDLGVAVAAYMAFQHTPARYKLEGG
EIENFRRQVESRRISMLRQGKYAGGARGGHGRDKRIKPIEQLRDKIANFR
DTTNHRYSRYIVDMAIKMGCGTIQMEDLTNIRDIGSRFLQNWTYYDLQQK
IIYKAEEAGIKVIKIDPQYTSQRCSECGNIDSGNRIGQAIFKCRACGYEA
NADYNAARNIAIPNIDKIIAESIK

3D structure

• PDB: 8j1j Minimal and most efficient genome editing Cas enzyme
• Chain: A
• Resolution: 2.91 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	I2 Q93 K96 Y105 H188 R261 R280 R291 R298 T327 T341 Y342 Y343	I4 Q95 K98 Y107 H190 R263 R282 R293 R300 T329 T343 Y344 Y345
BS02	dna	A	Y68 T69 H72 Y76 K80 N87 S88 S92 S147 S150 N151	Y70 T71 H74 Y78 K82 N89 S90 S94 S149 S152 N153
BS03	rna	A	I2 K3 V4 Y5 E8 K11 W17 R101 M114 S115 S118 Y119 K120 P124 I168 R170 A172 Q191 K198 K200 Y202 R260 S263 M264 L265 Q267 K269 G272 A274 G277 H278 G279 R280 K282 R283 I284 K285 P286 Q289 K293 N296 T300 H303 R304 R307 Y351 K352	I4 K5 V6 Y7 E10 K13 W19 R103 M116 S117 S120 Y121 K122 P126 I170 R172 A174 Q193 K200 K202 Y204 R262 S265 M266 L267 Q269 K271 G274 A276 G279 H280 G281 R282 K284 R285 I286 K287 P288 Q291 K295 N298 T302 H305 R306 R309 Y353 K354
BS04	ZN	A	C372 C391	C374 C393

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003723 RNA binding
• GO:0004519 endonuclease activity
• GO:0046872 metal ion binding

External links

• PDB: RCSB:8j1j, PDBe:8j1j, PDBj:8j1j
• PDBsum: 8j1j
• UniProt: A0A2U3D0N8|CS12F_SULT2 CRISPR-associated endodeoxyribonuclease Cas12f1 (Gene Name=cas12f1)