Structure of PDB 8izt Chain A |
>8iztA (length=123) Species: 10244 (Monkeypox virus) [Search protein sequence] |
ASMDKLRVLYDEFVTISKDNLERETGLSASDVDMDFDLNIFMTLVPVLEK KVCVITPTIEDDKIVTMMKYCSYQSFSFWFLKSGAVVKSVYNKLDDVEKE KFVATFRDMLLNVQTLISLNSMY |
|
PDB | 8izt Crystal structure of the N-terminal domain (residues 1-121) of MPXV A7 |
Chain | A |
Resolution | 1.74 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
D31 D33 |
D33 D35 |
|
|
|