Structure of PDB 8iy1 Chain A |
>8iy1A (length=92) Species: 270673 (Pseudomonas phage PaP2) [Search protein sequence] |
DNQHKKIKGYRDLSQEEIDMMNRVKELGSQFEKLIQDVSDHLRGQYNASL HNRDEITRIANAEPGRWLAIGKTDIQTGMMAIIRAIAQPDSF |
|
PDB | 8iy1 Phage anti-CBASS protein simultaneously sequesters cyclic trinucleotides and dinucleotides. |
Chain | A |
Resolution | 2.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
3AM |
A |
G66 R67 A70 T74 |
G65 R66 A69 T73 |
|
|
|