Structure of PDB 8iu1 Chain A

Receptor sequence

>8iu1A (length=138) Species: 9606 (Homo sapiens)

PLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPR
FNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVA
VNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI

3D structure

• PDB: 8iu1 Discovery and Exploration of Monosaccharide Linked Dimers to Target Fibrosis
• Chain: A
• Resolution: 1.97 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	QB2	A	R158 V160 H172 R176 N188 W195 E198	R32 V34 H46 R50 N62 W69 E72

Gene Ontology

Molecular Function

• GO:0030246 carbohydrate binding

External links

• PDB: RCSB:8iu1, PDBe:8iu1, PDBj:8iu1
• PDBsum: 8iu1
• UniProt: P16110|LEG3_MOUSE Galectin-3 (Gene Name=Lgals3)