Structure of PDB 8ito Chain A

Receptor sequence

>8itoA (length=73) Species: 882 (Nitratidesulfovibrio vulgaris str. Hildenborough)

ANPEDMWRCQTVNCGYVYDPDRGDKRGKVPPGTRFEDLPDEWRCPICKAT
KKCFRPLAGPGSTEQPQCEMPTD

3D structure

• PDB: 8ito Crystal structure of FeRlp from Desulfovibrio vulgaris (Hildenborough)
• Chain: A
• Resolution: 2.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FE	A	C10 C15 C45 C48	C9 C14 C44 C47

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0046872 metal ion binding

Biological Process

• GO:0043448 alkane catabolic process

External links

• PDB: RCSB:8ito, PDBe:8ito, PDBj:8ito
• PDBsum: 8ito
• UniProt: Q726L3