Structure of PDB 8ita Chain A

Receptor sequence

>8itaA (length=429) Species: 58944 (Iris domestica)

PTTVVLYPSPGMGHLVSMFELAKLLDRHGLSVTVIIVEPHGSTAAFIARS
SASNPSVSFRVLPRPEAHAFDLLRLSNPELRRFLLESPPSALVLDYFCGN
ALDVSAELRIPAYYFFTSGAGVLSAFLHFPDLHSRTAASFREMGSSPLHF
PGIPPLPADHMPVPMLDRDDPVYESFLYFSKRLKEAEGYIINTFEDLEPR
AVAAISDAALPPNYCIGPLIQSRGGSECLAWLDAQPKRSVVFLCFGSIGL
FSSEQLKEMAVGLERSGQRFLWVVRSPPSEPDLERILPEGFLERTEGRGL
VVKSWAPQAAVLEHGSVGGFVTHCGWNSTLEAIASGVPMVAWPMYAEQWM
NKVFLVEEMKLAVPMEGYDKDMVTAEEVERKVRWLMESEGGVELRARTER
AKERAAASLAEGGKSKVALLEVVERMKRG

3D structure

• PDB: 8ita Functional characterization and structural basis of a reversible glycosyltransferase involves in plant chemical defence.
• Chain: A
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	R0U	A	H18 S21 T135 F144 P180 P182 A383 E384	H14 S17 T117 F126 P162 P164 A346 E347
BS02	UDP	A	C270 S273 W342 A343 Q345 H360 G362 N364 S365 E368 Y382	C244 S247 W305 A306 Q308 H323 G325 N327 S328 E331 Y345

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Dec 3 03:23:13 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8ita', asym_id = 'A', title = 'Functional characterization and structural basis...yltransferase involves in plant chemical defence.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8ita', asym_id='A', title='Functional characterization and structural basis...yltransferase involves in plant chemical defence.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0008194,0035251', uniprot = '', pdbid = '8ita', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0008194,0035251', uniprot='', pdbid='8ita', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>