Structure of PDB 8ipx Chain A

Receptor sequence
>8ipxA (length=45) Species: 9606 (Homo sapiens) [Search protein sequence]
LKKMQANNAKAMSRKLDRLAYIAHPKLGKRARARIAKGLRLCRPK
3D structure
PDB8ipx Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.
ChainA
Resolution4.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A K56 K92 R95 Y98 K103 R107 R111 K114 G115 R117 L118 K122 K3 K15 R18 Y21 K26 R30 R34 K37 G38 R40 L41 K45
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008201 heparin binding
GO:0045296 cadherin binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0007566 embryo implantation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0016020 membrane
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ipx, PDBe:8ipx, PDBj:8ipx
PDBsum8ipx
PubMed37491604
UniProtP47914|RL29_HUMAN Large ribosomal subunit protein eL29 (Gene Name=RPL29)

[Back to BioLiP]