Structure of PDB 8ili Chain A

Receptor sequence
>8iliA (length=177) Species: 10498 (African swine fever virus BA71V) [Search protein sequence]
GGGMLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKML
NDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTY
QLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQT
LVPLKITTEKELIKELGFTYRIPKKRL
3D structure
PDB8ili Structural Insight into Polymerase Mechanism via a Chiral Center Generated with a Single Selenium Atom.
ChainA
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.7.7: DNA-directed DNA polymerase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A D51 H115 F116 V120 L123 R127 D54 H118 F119 V123 L126 R130
BS02 dna A V80 C81 G82 R84 K85 I124 R127 K131 K136 L137 N138 Q139 Y140 V83 C84 G85 R87 K88 I127 R130 K134 K139 L140 N141 Q142 Y143
BS03 MG A D49 D51 D52 D54
BS04 MG A D49 D51 D100 D52 D54 D103
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003887 DNA-directed DNA polymerase activity
GO:0016779 nucleotidyltransferase activity
GO:0046872 metal ion binding
Biological Process
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0006303 double-strand break repair via nonhomologous end joining
GO:0071897 DNA biosynthetic process
Cellular Component
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ili, PDBe:8ili, PDBj:8ili
PDBsum8ili
PubMed37958741
UniProtP42494|DPOLX_ASFB7 Repair DNA polymerase X (Gene Name=Ba71V-97)

[Back to BioLiP]