Structure of PDB 8ile Chain A

Receptor sequence
>8ileA (length=170) Species: 10498 (African swine fever virus BA71V) [Search protein sequence]
MLTLIQGKKIVNHLRSRLAFELIKILSKNIVAVGSLRREEKMLNDVDLLI
IVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTA
LAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKIT
TEKELIKELGFTYRIPKKRL
3D structure
PDB8ile Structural Insight into Polymerase Mechanism via a Chiral Center Generated with a Single Selenium Atom.
ChainA
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.7.7: DNA-directed DNA polymerase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A V80 C81 G82 R84 K85 I124 R127 K136 Y140 V76 C77 G78 R80 K81 I120 R123 K132 Y136
BS02 MN A D49 D51 D45 D47
BS03 MN A D49 D51 D100 D45 D47 D96
BS04 7Q6 A G38 S39 R42 N48 D49 D51 H115 F116 T117 V120 G34 S35 R38 N44 D45 D47 H111 F112 T113 V116
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003887 DNA-directed DNA polymerase activity
GO:0016779 nucleotidyltransferase activity
GO:0046872 metal ion binding
Biological Process
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0006303 double-strand break repair via nonhomologous end joining
GO:0071897 DNA biosynthetic process
Cellular Component
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ile, PDBe:8ile, PDBj:8ile
PDBsum8ile
PubMed37958741
UniProtP42494|DPOLX_ASFB7 Repair DNA polymerase X (Gene Name=Ba71V-97)

[Back to BioLiP]