Structure of PDB 8ifu Chain A

Receptor sequence
>8ifuA (length=259) Species: 42384 (Hyphochytrium catenoides) [Search protein sequence]
PFCGGRPEDGWHHGSIHDMDYPLLGAMAAICSVFIGGSGAWMLYRLDLGL
GYSCKPHHSGYAPEANSFSALSCLVSGTIYAAKTFDFFDGGGTPFSFNWY
WYLDYVFTCPLILLDVLYTLEIPHKLRFVFAVIITLWCGVAAFVTPSAFR
FGYYAVGCVWFVPFSFSLLRHVKQRYQVYPPKCQKILFWACTIFFGFWPL
FPILFLFSWLGTGHIDQQAFTIIHAFLDLFCKTVFGLIMTFFRLELEEHT
EVLGLPLNE
3D structure
PDB8ifu Structure of HcCCR
ChainA
Resolution2.37 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 RET A Y103 Y106 C110 Y155 G158 C159 F162 W199 F202 P203 Y102 Y105 C109 Y154 G157 C158 F161 W198 F201 P202
BS02 L9Q A Y119 L127 F131 Y118 L126 F130
BS03 L9Q A P2 F3 P95 F96 F108 P1 F2 P94 F95 F107
BS04 L9Q A Y101 I135 W138 C139 V145 Y100 I134 W137 C138 V144
BS05 L9Q A E65 Y119 E64 Y118
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Tue Dec 3 06:49:04 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8ifu', asym_id = 'A', title = 'Structure of HcCCR'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8ifu', asym_id='A', title='Structure of HcCCR')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0016020', uniprot = '', pdbid = '8ifu', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016020', uniprot='', pdbid='8ifu', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>