Structure of PDB 8hpt Chain A

Receptor sequence
>8hptA (length=255) Species: 10090 (Mus musculus) [Search protein sequence]
GDVAALIIYSVVFLVGVPGNALVVWVTAFEAVNAIWFLNLAVADLLSCLA
LPVLFTTVLNHNYWYFDATACIVLPSLILLNMYASILLLATISADRFLLV
FKPIWCQKVRGTGLAWMACGVAWVLALLLTIPSFVYREAYKAVAILRLMV
GFVLPLLTLNICYTFLLLRTWSRKATRSTKTLKVVMAVVICFFIFWLPYQ
VTGVMIAWLPPSSPTLKRVEKLNSLCVSLAYINCCVNPIIYVMAGQGFHG
RLLRS
3D structure
PDB8hpt Structure of a GPCR-G protein in complex with a synthetic peptide agonist
ChainA
Resolution3.39 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A I116 L117 Y174 R175 Y178 Y259 T262 G263 N283 I78 L79 Y136 R137 Y140 Y199 T202 G203 N223
Gene Ontology
Molecular Function
GO:0004875 complement receptor activity
GO:0004878 complement component C5a receptor activity
GO:0004930 G protein-coupled receptor activity
Biological Process
GO:0001774 microglial cell activation
GO:0002684 positive regulation of immune system process
GO:0006935 chemotaxis
GO:0007186 G protein-coupled receptor signaling pathway
GO:0010575 positive regulation of vascular endothelial growth factor production
GO:0010759 positive regulation of macrophage chemotaxis
GO:0030593 neutrophil chemotaxis
GO:0032494 response to peptidoglycan
GO:0038178 complement component C5a signaling pathway
GO:0042789 mRNA transcription by RNA polymerase II
GO:0045766 positive regulation of angiogenesis
GO:0048143 astrocyte activation
GO:0050679 positive regulation of epithelial cell proliferation
GO:0050830 defense response to Gram-positive bacterium
GO:0050890 cognition
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0090023 positive regulation of neutrophil chemotaxis
GO:0097242 amyloid-beta clearance
GO:0099172 presynapse organization
GO:1902947 regulation of tau-protein kinase activity
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0016323 basolateral plasma membrane
GO:0031410 cytoplasmic vesicle
GO:0045177 apical part of cell

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hpt, PDBe:8hpt, PDBj:8hpt
PDBsum8hpt
PubMed37852260
UniProtP30993|C5AR1_MOUSE C5a anaphylatoxin chemotactic receptor 1 (Gene Name=C5ar1)

[Back to BioLiP]