Structure of PDB 8ho6 Chain A

Receptor sequence

>8ho6A (length=281) Species: 128810 (Saccharum hybrid cultivar)

NLHVFTIAELRAVTRDFSMTNFIGEGGFGPVYKGYVHDLAAQTVAVKLLD
LEGGQGHTEWQTEVFFLGQLRHPHLVKLIGYCYEDEHRLLVYEFMTRGSL
EKHLFSLPWSTRLKIAIGAAKGLAFLHEAKPVIYRDFKTSNILLDSDYKA
KLSDFGLAKDGPDETHVSTRVMGTQGYAAPEYIMTGHLTAKSDVYGYGVV
LLELLSGRKAVDKEQSLVEWARPYLTDARRLDRVMDPSLAGQYSTRAAHK
AAAVAHQCVALNPKSRPHMSAVVDALEPLLA

3D structure

• PDB: 8ho6 Receptor-like cytoplasmic kinase ScRIPK in sugarcane regulates disease resistance and drought tolerance in Arabidopsis.
• Chain: A
• Resolution: 2.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	A	G25 E26 G27 G28 F29 V32 A51 K53 M101 S105 K150 L155 D166	G24 E25 G26 G27 F28 V31 A45 K47 M95 S99 K138 L143 D154

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Dec 1 11:59:47 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8ho6', asym_id = 'A', title = 'Receptor-like cytoplasmic kinase ScRIPK in sugar... resistance and drought tolerance in Arabidopsis.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8ho6', asym_id='A', title='Receptor-like cytoplasmic kinase ScRIPK in sugar... resistance and drought tolerance in Arabidopsis.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004672,0005524,0006468', uniprot = '', pdbid = '8ho6', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004672,0005524,0006468', uniprot='', pdbid='8ho6', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>