Structure of PDB 8hlo Chain A

Receptor sequence
>8hloA (length=67) Species: 10090 (Mus musculus) [Search protein sequence]
GPGSEFVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQ
PERKGVFPVSFVHILSD
3D structure
PDB8hlo Crystal Structure of the SH3 Domain of ASAP1 in Complex with the Proline Rich Motif (PRM) of MICAL1 Reveals a Unique SH3/PRM Interaction Mode.
ChainA
Resolution1.168 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A Y1094 D1095 C1096 D1099 D1102 E1103 E1118 D1119 W1122 V1136 F1141 Y14 D15 C16 D19 D22 E23 E38 D39 W42 V56 F61
Gene Ontology
Molecular Function
GO:0005096 GTPase activator activity
Biological Process
GO:0043547 positive regulation of GTPase activity

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8hlo, PDBe:8hlo, PDBj:8hlo
PDBsum8hlo
PubMed36674928
UniProtQ9QWY8|ASAP1_MOUSE Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (Gene Name=Asap1)

[Back to BioLiP]