Structure of PDB 8hjx Chain A |
>8hjxA (length=118) Species: 243274 (Thermotoga maritima MSB8) [Search protein sequence] |
GPSGMILKRAYDVTPQKISTDKVRGVRKRVLIGLKDAPNFVMRLFTVEPG GLIDRASHPWEEEIFVLKGKLTVLKEQGEETVEEGFYIFVEPNEIHGFRN DTDSEVEFLCLIPKEGGE |
|
PDB | 8hjx An artificial metallolyase with pliable 2-His-1-carboxylate facial triad for stereoselective Michael addition. |
Chain | A |
Resolution | 1.15 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H54 E58 H92 |
H58 E62 H96 |
|
|
|
|