Structure of PDB 8hib Chain A |
>8hibA (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] |
AVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGF LHSWWCVFWDLYCAAPERRETCEHSSEAKAFHD |
|
PDB | 8hib The crystal structure of Pygo2-LDB1-SSBP2 triple complex |
Chain | A |
Resolution | 2.45 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
H32 V33 P58 Y72 |
H22 V23 P48 Y62 |
|
|
|
|