Structure of PDB 8hgi Chain A

Receptor sequence
>8hgiA (length=220) Species: 32630 (synthetic construct) [Search protein sequence]
ASVIKPEMKIKLRMEGAVNGHKFVIEGEGIGKPYEGTQTLDLTVKEGAPL
PFSYDILTPAFNRAFTKYPKDIPDYFKQAFPEGYSWERSMTYEDQGICIA
TSDITMEGDCFFYKIRFDGTNFPPNGPVMQKKTLKWEPSTEKMYVRDGVL
KGDVNMALLLEGGGHYRCDFKTTYKAKKDVRLPDAHKVDHRIEILSHDKD
YNKVRLYEHAEARYSMLPSQ
3D structure
PDB8hgi Selection, identification and crystal structure of shark-derived single-domain antibodies against a green fluorescent protein.
ChainA
Resolution1.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CRQ A Q42 L44 P63 A64 F65 N69 R70 W93 R95 S146 M163 H197 I199 L213 Y214 E215 Q38 L40 P59 A60 F61 N62 R63 W86 R88 S139 M156 H190 I192 L206 Y207 E208
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Wed Dec 4 04:36:34 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8hgi', asym_id = 'A', title = 'Selection, identification and crystal structure ...n antibodies against a green fluorescent protein.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8hgi', asym_id='A', title='Selection, identification and crystal structure ...n antibodies against a green fluorescent protein.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0006091,0008218', uniprot = '', pdbid = '8hgi', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006091,0008218', uniprot='', pdbid='8hgi', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>