Structure of PDB 8hg9 Chain A

Receptor sequence

>8hg9A (length=392) Species: 1409 (Bacillus sp. (in: firmicutes))

EVIPVNEITNFKSRAEEFFPIEWYKDMLHHHPVYYHEQTNTWNVFTYEGV
KQVLGNYEFFSSAGPRTTIFPLTNLTLVDPPDHRKGRSLLAAAFTPRSLK
NWEPRIKQIAEELVENIQDNNEINIVEALAAPLPSMVIADLFGVPIQDRA
QFKEWVDILFQPYLEDIELQKQNAAKEYFQYLYPIVVQKRSNLSDDIISD
LIQAEVDGEKFTDNEIVQVTMLLLGAGVETTSHAIANTFYSLLYDDESLY
GELRNDLELVPNAVEEMLRYRFHMSRRDRTVKKDNNLLGVELKEGDVVIA
WMSACNMDHRMFDDPFSINIHRPNNKKHLTFGNGPHFCLGAPLARLEMKI
ALETFVKKFSSIEPVEGFELEKNLTASATGQSLTNLPMNVYK

3D structure

• PDB: 8hg9 Crystal Structure and Biochemical Analysis of a Cytochrome P450 Steroid Hydroxylase ( Ba CYP106A6) from Bacillus Species.
• Chain: A
• Resolution: 2.79 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	L89 H97 R101 L241 A244 G245 T248 F290 R295 R297 T348 F349 G350 H354 C356 G358 A362	L75 H83 R87 L223 A226 G227 T230 F272 R277 R279 T330 F331 G332 H336 C338 G340 A344

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Nov 27 21:45:38 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8hg9', asym_id = 'A', title = 'Crystal Structure and Biochemical Analysis of a ...Hydroxylase ( Ba CYP106A6) from Bacillus Species.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8hg9', asym_id='A', title='Crystal Structure and Biochemical Analysis of a ...Hydroxylase ( Ba CYP106A6) from Bacillus Species.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004497,0005506,0016705,0020037', uniprot = '', pdbid = '8hg9', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004497,0005506,0016705,0020037', uniprot='', pdbid='8hg9', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>