Structure of PDB 8h2f Chain A

Receptor sequence

>8h2fA (length=172) Species: 1268061 (Streptococcus thermophilus DGCC 7710)

SKPYVVIDIETDGLDEKKNTIIEIGAVKFNGQQVEEFNALIKYEEKLPPT
IFKLTGISKSLLDQEGRDLKEVLSEFLLFIGDLTLVGYNIHFDIQFINNK
LNKFGLPLLINKTHDIMRYVKDEKLFLDNYQLQTALKSYGIEDSVPHRAL
KDARLIYHLSTKVNKFLARMKE

3D structure

• PDB: 8h2f DnaQ mediates directional spacer acquisition in the CRISPR-Cas system by a time-dependent mechanism.
• Chain: A
• Resolution: 1.448 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	TMP	A	E137 T138 L181 F219 H274	E10 T11 L54 F92 H147
BS02	MG	A	D135 E137 D279	D8 E10 D152

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 01:35:36 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8h2f', asym_id = 'A', title = 'DnaQ mediates directional spacer acquisition in the CRISPR-Cas system by a time-dependent mechanism.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8h2f', asym_id='A', title='DnaQ mediates directional spacer acquisition in the CRISPR-Cas system by a time-dependent mechanism.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003676,0003677,0003887,0006260', uniprot = '', pdbid = '8h2f', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0003677,0003887,0006260', uniprot='', pdbid='8h2f', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>