Structure of PDB 8h1j Chain A

Receptor sequence

>8h1jA (length=362) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539)

MIRNKAFVVRLYPNAAQTELINRTLGSARFVYNHFLARRIAAYKESGKGL
TYGQTSSELTLLKQAEETSWLSEVDKFALQNSLKNLETAYKNFFRTVKQS
GKKVGFPRFRKKRTGESYRTQFTNNNIQIGEGRLKLPKLGWVKTKGQQDI
QGKILNVTVRRIHEGHYEASVLCEVEIPYLPAAPKFAAGVDVGIKDFAIV
TDGVRFKHEQNPKYYRSTLKRLRKAQQTLSRRKKGSARYGKAKTKLARIH
KRIVNKRQDFLHKLTTSLVREYEIIGTEHLDAGWGEFIRQLEYKAAWYGR
LVSKVSPYFPSSQLCHDCGFKNPEVKNLAVRTWTCPNCGETHDRDENAAL
NIRREALVAAGI

3D structure

• PDB: 8h1j Cryo-EM structure of the transposon-associated TnpB enzyme.
• Chain: A
• Resolution: 3.1 Å

Enzymatic activity

• Enzyme Commision number: 3.1.21.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	N4 R95 K111 T114 Q121 N156	N4 R95 K111 T114 Q121 N156
BS02	rna	A	N4 A6 V8 A89 N92 G105 R110 S117 K143 G146 Q148 R160 S170 Y214 K220 R221 R223 Q227 R231 R232 K234 S236 A237 R238 K256 D259 H262 K263 T266 R270 Y309 W313	N4 A6 V8 A89 N92 G105 R110 S117 K143 G146 Q148 R160 S170 Y214 K220 R221 R223 Q227 R231 R232 K234 S236 A237 R238 K256 D259 H262 K263 T266 R270 Y293 W297
BS03	dna	A	Y52 S56 T60 K63 K76 F77 N124 K138	Y52 S56 T60 K63 K76 F77 N124 K138
BS04	ZN	A	C331 C351 C354	C315 C335 C338

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003723 RNA binding
• GO:0004519 endonuclease activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006310 DNA recombination
• GO:0032196 transposition

External links

• PDB: RCSB:8h1j, PDBe:8h1j, PDBj:8h1j
• PDBsum: 8h1j
• PubMed: 37020030
• UniProt: Q7DF80|DRA2B_DEIRA RNA-guided DNA endonuclease TnpB (Gene Name=tnpB)