Structure of PDB 8gt1 Chain A

Receptor sequence

>8gt1A (length=362) Species: 9606 (Homo sapiens) [Search protein sequence]

TTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQDSYVGDEAQSKRG
ILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEGPLNPK
ANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNV
PIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIK
EKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQ
PSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRM
QKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYD
EAGPSIVHRKCF

3D structure

PDB

8gt1 Mutagenic analysis of actin reveals the mechanism of His161 flipping that triggers ATP hydrolysis.

Chain

Resolution

1.35 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.4.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	A	G13 S14 G15 L16 K18 G156 D157 G182 R210 K213 E214 G301 G302 M305 Y306 K336	G9 S10 G11 L12 K14 G143 D144 G169 R197 K200 E201 G288 G289 M292 Y293 K323
BS02	ATP	A	G13 S14 G15 L16 K18 G156 D157 G158 V159 G182 R210 K213 E214 G301 G302 M305 Y306 K336	G9 S10 G11 L12 K14 G143 D144 G145 V146 G169 R197 K200 E201 G288 G289 M292 Y293 K323

Gene Ontology

	Molecular Function
GO:0000146	microfilament motor activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0016787	hydrolase activity
GO:0017022	myosin binding

	Biological Process
GO:0007015	actin filament organization
GO:0010628	positive regulation of gene expression
GO:0030048	actin filament-based movement
GO:0030240	skeletal muscle thin filament assembly
GO:0031032	actomyosin structure organization
GO:0033275	actin-myosin filament sliding
GO:0043066	negative regulation of apoptotic process
GO:0055003	cardiac myofibril assembly
GO:0055008	cardiac muscle tissue morphogenesis
GO:0060047	heart contraction
GO:0070252	actin-mediated cell contraction
GO:0090131	mesenchyme migration

	Cellular Component
GO:0005615	extracellular space
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005884	actin filament
GO:0005925	focal adhesion
GO:0016020	membrane
GO:0030017	sarcomere
GO:0030027	lamellipodium
GO:0030175	filopodium
GO:0031674	I band
GO:0044297	cell body
GO:0045202	synapse
GO:0070062	extracellular exosome
GO:0072562	blood microparticle
GO:0098978	glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8gt1, PDBe:8gt1, PDBj:8gt1
PDBsum	8gt1
PubMed	37009486
UniProt	P68032\|ACTC_HUMAN Actin, alpha cardiac muscle 1 (Gene Name=ACTC1)

[Back to BioLiP]