Structure of PDB 8gis Chain A

Receptor sequence

>8gisA (length=356) Species: 10090 (Mus musculus)

DKLKKVLDKLRLKRKDISEAAETVNKVVERLLRRMQKRESEFKGVEQLNT
GSYYEHVKISAPNEFDVMFKLEVPRIELQEYYETGAFYLVKFKRINPLSH
FLEGEVLSATKMLSKFRKIIKEEVKEIKDIDVSVEKEKPGSPAVTLLIRN
PEEISVDIILALESKGSWPISTKEGLPIQGWLGTKVRTNLRREPFYLVPK
NAKDGNSFQGETWRLSFSHTEKYILNNHGIEKTCCESSGAKCCRKECLKL
MKYLLEQLKKEFQELDAFCSYHVKTAIFHMWTQDPQDSQWDPRNLSSCFD
KLLAFFLECLRTEKLDHYFIPKFNLFSQELIDRKSKEFLSKKIEYERNNG
FPIFDK

3D structure

• PDB: 8gis Structure of Ternary Complex of mouse cGAS with dsDNA and Bound ATP: with 10mM Mg2+ and 0.5mM Mn2+
• Chain: A
• Resolution: 2.46 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.86: cyclic GMP-AMP synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	R158 L159 K160 R161 E386 K395	R11 L12 K13 R14 E236 K245
BS02	dna	A	R161 S165 A168 N196 Y200 Y201 K372	R14 S18 A21 N49 Y53 Y54 K222
BS03	dna	A	T334 K335 T338	T184 K185 T188
BS04	ATP	A	G198 S199 E211 D213 R364 S368 E371 K402 S420 Y421	G51 S52 E64 D66 R214 S218 E221 K252 S270 Y271
BS05	ZN	A	H378 C385 C392	H228 C235 C242
BS06	MN	A	E211 D213 D307	E64 D66 D157
BS07	MN	A	E211 D213	E64 D66

External links

• PDB: RCSB:8gis, PDBe:8gis, PDBj:8gis
• PDBsum: 8gis
• PubMed: 38740774
• UniProt: Q8C6L5|CGAS_MOUSE Cyclic GMP-AMP synthase (Gene Name=Cgas)