Structure of PDB 8gi8 Chain A

Receptor sequence

>8gi8A (length=240) Species: 42384 (Hyphochytrium catenoides)

INDMDYPLLGSICAVCCVFVAGSGIWMLYRLDLGMGYSCKPYKSGRAPEV
NSLSGIICLLCGTMYAAKSFDFFDGGGTPFSLNWYWYLDYVFTCPLLILD
FAFTLDLPHKIRYFFAVFLTLWCGVAAFVTPSAYRFAYYALGCCWFTPFA
LSLMRHVKERYLVYPPKCQRWLFWACVIFFGFWPMFPILFIFSWLGTGHI
SQQAFYIIHAFLDLTCKSIFGILMTVFRLELEEHTEVQGL

3D structure

• PDB: 8gi8 Structures of channelrhodopsin paralogs in peptidiscs explain their contrasting K+ and Na+ selectivities
• Chain: A
• Resolution: 2.88 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	RET	A	Y103 Y106 C110 T136 G140 Y155 F162 W199 F202 P203 C232 K233	Y87 Y90 C94 T120 G124 Y139 F146 W183 F186 P187 C216 K217
BS02	CLR	A	W190 F198 T231 I235	W174 F182 T215 I219
BS03	CLR	A	Y177 F189 C192 V193	Y161 F173 C176 V177
BS04	CLR	A	F152 C159 I207	F136 C143 I191

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Dec 1 15:05:31 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8gi8', asym_id = 'A', title = 'Structures of channelrhodopsin paralogs in pepti...xplain their contrasting K+ and Na+ selectivities'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8gi8', asym_id='A', title='Structures of channelrhodopsin paralogs in pepti...xplain their contrasting K+ and Na+ selectivities')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016020', uniprot = '', pdbid = '8gi8', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016020', uniprot='', pdbid='8gi8', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>