Structure of PDB 8gcr Chain A

Receptor sequence

MFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDL
CIVYRDGNPYAVCDKCLKFYSKISEYRHYSYSLYGTTLEQQYNKPLSDLL
IRCINCQKPLSPEEKQRHLDKKQRFHNIRGRWTGRCMSCS

3D structure

PDB

8gcr Structure of the p53 degradation complex from HPV16.

Chain

Resolution

3.38 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C37 C40 C73	C30 C33 C66
BS02	ZN	A	C110 C113 C146	C103 C106 C139

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0015144	carbohydrate transmembrane transporter activity
GO:0030165	PDZ domain binding
GO:0042802	identical protein binding
GO:0046872	metal ion binding
GO:1901982	maltose binding

	Biological Process
GO:0006351	DNA-templated transcription
GO:0006355	regulation of DNA-templated transcription
GO:0006974	DNA damage response
GO:0008643	carbohydrate transport
GO:0015768	maltose transport
GO:0019049	virus-mediated perturbation of host defense response
GO:0030162	regulation of proteolysis
GO:0034219	carbohydrate transmembrane transport
GO:0034289	detection of maltose stimulus
GO:0039502	symbiont-mediated suppression of host type I interferon-mediated signaling pathway
GO:0039548	symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of IRF3 activity
GO:0039648	symbiont-mediated perturbation of host ubiquitin-like protein modification
GO:0039653	symbiont-mediated suppression of host transcription
GO:0042956	maltodextrin transmembrane transport
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0052150	symbiont-mediated perturbation of host apoptosis
GO:0055085	transmembrane transport
GO:0060326	cell chemotaxis
GO:0090630	activation of GTPase activity

	Cellular Component
GO:0016020	membrane
GO:0030288	outer membrane-bounded periplasmic space
GO:0030430	host cell cytoplasm
GO:0042025	host cell nucleus
GO:0042597	periplasmic space
GO:0043190	ATP-binding cassette (ABC) transporter complex
GO:0055052	ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
GO:1990060	maltose transport complex

External links

PDB	RCSB:8gcr, PDBe:8gcr, PDBj:8gcr
PDBsum	8gcr
PubMed	38418456
UniProt	P03126\|VE6_HPV16 Protein E6 (Gene Name=E6); P0AEX9\|MALE_ECOLI Maltose/maltodextrin-binding periplasmic protein (Gene Name=malE)